PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10025926m
Common NameCICLE_v10025926mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ZF-HD
Protein Properties Length: 364aa    MW: 40541.6 Da    PI: 8.5918
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10025926mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.92.1e-32139194359
      ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                      ++rY+eClkNhAa++G h++DGCgEfmps ge+gt+++lkCaAC+CHRnFHR+e + 
  Ciclev10025926m 139 SIRYRECLKNHAANMGNHVIDGCGEFMPS-GEDGTPEGLKCAACDCHRNFHRKEIDG 194
                      689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047705.3E-30140192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257749.0E-21141194IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.7E-30141192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.03142191IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.76E-19285360IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29288362IPR009057Homeodomain-like
TIGRFAMsTIGR015654.1E-27299356IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MELQGKEKEI GMTSSMRYNR DSSSTVSTPI NSIAGEMIRD QGTVHGEAIF NLPQTLDQHQ  60
HPPYRHHQLN SQQQQQPQTQ QNLQNKPSAG SSNPEAQHPD PVPVSVANTT TNTKEANRSN  120
QRSPAQAPTT STAIITASSI RYRECLKNHA ANMGNHVIDG CGEFMPSGED GTPEGLKCAA  180
CDCHRNFHRK EIDGDSQSQS QYAAHSLYPY NYPSRNNSTQ RNHHHQQQQQ PPPPFHHLQQ  240
HHRISYTSPQ TASIAPMMMT FGGGGGAGGS SGGLDESSSE DLNMFHSSAG GQTSMQAKKK  300
RFRTKFSQEQ KDKMMEFAET LGWRIQKQDD QQVHDFCTQV GVKRQVFKVW MHNNKQASKK  360
KHE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-233003551873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425664.10.0hypothetical protein CICLE_v10025926mg
RefseqXP_006466804.10.0PREDICTED: zinc-finger homeodomain protein 6-like
TrEMBLV4UHS40.0V4UHS4_9R
STRINGPOPTR_0007s12970.12e-87(Populus trichocarpa)
STRINGPOPTR_0005s12420.13e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.13e-57homeobox protein 24